Lineage for d3bimf_ (3bim F:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1411215Fold d.42: POZ domain [54694] (1 superfamily)
    core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143
  4. 1411216Superfamily d.42.1: POZ domain [54695] (3 families) (S)
  5. 1411217Family d.42.1.1: BTB/POZ domain [54696] (6 proteins)
  6. 1411218Protein B-cell lymphoma 6 (Bcl6) protein BTB domain [102922] (1 species)
  7. 1411219Species Human (Homo sapiens) [TaxId:9606] [102923] (6 PDB entries)
  8. 1411238Domain d3bimf_: 3bim F: [155316]
    automated match to d1r2ba_
    protein/DNA complex

Details for d3bimf_

PDB Entry: 3bim (more details), 2.6 Å

PDB Description: crystal structure of the bcl6 btb domain dimer in complex with the bcor bbd corepressor peptide
PDB Compounds: (F:) B-cell lymphoma 6 protein

SCOPe Domain Sequences for d3bimf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bimf_ d.42.1.1 (F:) B-cell lymphoma 6 (Bcl6) protein BTB domain {Human (Homo sapiens) [TaxId: 9606]}
adsqiqftrhasdvllnlnrlrsrdiltdvvivvsreqfrahktvlmacsglfysiftdq
lkrnlsvinldpeinpegfnilldfmytsrlnlregnimavmatamylqmehvvdtcrkf
ik

SCOPe Domain Coordinates for d3bimf_:

Click to download the PDB-style file with coordinates for d3bimf_.
(The format of our PDB-style files is described here.)

Timeline for d3bimf_: