SCOPe 2.08: Domain d3bikc_: 3bik C:

Lineage for d3bikc_ (3bik C:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Programmed cell death protein 1, PD1, extracellular domain [101510] (2 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [101511] (5 PDB entries)

8. Domain d3bikc_: 3bik C: [155310]
   automated match to d1npua_
   complexed with gol

Details for d3bikc_

PDB Entry: 3bik, 2.65 Å

PDB Description: crystal structure of the pd-1/pd-l1 complex

PDB Compounds: (C:) Programmed cell death protein 1

SCOPe Domain Sequences for d3bikc_:

Sequence; same for both SEQRES and ATOM records:

>d3bikc_ b.1.1.1 (C:) Programmed cell death protein 1, PD1, extracellular domain {Mouse (Mus musculus) [TaxId: 10090]}
gpwrsltfypawltvseganatftcslsnwsedlmlnwnrlspsnqtekqaafsnglsqp
vqdarfqiiqlpnrhdfhmnildtrrndsgiylcgaislhpkakieespgaelvvter

Timeline for d3bikc_:

• d3bikc_ first appeared in SCOP 1.75, called d3bikc1
  
• d3bikc_ appears in SCOPe 2.07