| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
| Protein Programmed cell death protein 1, PD1, extracellular domain [101510] (2 species) |
| Species Mouse (Mus musculus) [TaxId:10090] [101511] (5 PDB entries) |
| Domain d3bikc_: 3bik C: [155310] automated match to d1npua_ complexed with gol |
PDB Entry: 3bik (more details), 2.65 Å
SCOPe Domain Sequences for d3bikc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3bikc_ b.1.1.1 (C:) Programmed cell death protein 1, PD1, extracellular domain {Mouse (Mus musculus) [TaxId: 10090]}
gpwrsltfypawltvseganatftcslsnwsedlmlnwnrlspsnqtekqaafsnglsqp
vqdarfqiiqlpnrhdfhmnildtrrndsgiylcgaislhpkakieespgaelvvter
Timeline for d3bikc_: