Lineage for d3bikb1 (3bik B:34-148)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 781542Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 781543Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 781544Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (32 proteins)
  6. 783721Protein Programmed cell death protein 1, PD1, extracellular domain [101510] (1 species)
  7. 783722Species Mouse (Mus musculus) [TaxId:10090] [101511] (3 PDB entries)
  8. 783725Domain d3bikb1: 3bik B:34-148 [155309]
    automatically matched to d1npua_
    complexed with gol; mutant

Details for d3bikb1

PDB Entry: 3bik (more details), 2.65 Å

PDB Description: Crystal Structure of the PD-1/PD-L1 Complex
PDB Compounds: (B:) Programmed cell death protein 1

SCOP Domain Sequences for d3bikb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bikb1 b.1.1.1 (B:34-148) Programmed cell death protein 1, PD1, extracellular domain {Mouse (Mus musculus) [TaxId: 10090]}
sltfypawltvseganatftcslsnwsedlmlnwnrlspsnqtekqaafsnglsqpvqda
rfqiiqlpnrhdfhmnildtrrndsgiylcgaislhpkakieespgaelvvteri

SCOP Domain Coordinates for d3bikb1:

Click to download the PDB-style file with coordinates for d3bikb1.
(The format of our PDB-style files is described here.)

Timeline for d3bikb1: