SCOPe 2.05: Domain d3biie_: 3bii E:

Lineage for d3biie_ (3bii E:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.41: alpha/beta-Hammerhead [54664] (5 superfamilies)
   core: beta-BETA-alpha-beta-BETA-beta-alpha; contains a beta-hammerhead motif similar to that in barrel-sandwich hybrids

4. Superfamily d.41.5: Molybdopterin synthase subunit MoaE [54690] (2 families)

5. Family d.41.5.1: Molybdopterin synthase subunit MoaE [54691] (1 protein)
   automatically mapped to Pfam PF02391

6. Protein Molybdopterin synthase subunit MoaE [54692] (1 species)

7. Species Escherichia coli [TaxId:562] [54693] (5 PDB entries)

8. Domain d3biie_: 3bii E: [155308]
   Other proteins in same PDB: d3biid_
   automated match to d1fm0e_
   complexed with cl

Details for d3biie_

PDB Entry: 3bii, 2.5 Å

PDB Description: crystal structure of activated mpt synthase

PDB Compounds: (E:) Molybdopterin-converting factor subunit 2

SCOPe Domain Sequences for d3biie_:

Sequence, based on SEQRES records:

>d3biie_ d.41.5.1 (E:) Molybdopterin synthase subunit MoaE {Escherichia coli [TaxId: 562]}
aetkivvgpqpfsvgeeypwlaerdedgavvtftgkvrnhnlgdsvnaltlehypgmtek
alaeivdearnrwplgrvtvihrigelwpgdeivfvgvtsahrssafeagqfimdylktr
apfwkreatpegdrwvearesdqqaakrw

Sequence, based on observed residues (ATOM records):

>d3biie_ d.41.5.1 (E:) Molybdopterin synthase subunit MoaE {Escherichia coli [TaxId: 562]}
aetkivvgpqpfsvgeeypwlaerdedgavvtftgkvrvnaltlehypgmtekalaeivd
earnrwplgrvtvihrigelwpgdeivfvgvtsahrssafeagqfimdylktrapfwkre
atpegdrwvearesdqqaakrw

Timeline for d3biie_:

• d3biie_ first appeared in SCOP 1.75, called d3biie1
  
• d3biie_ appears in SCOPe 2.04
  
• d3biie_ appears in SCOPe 2.06
  
• d3biie_ appears in the current release, SCOPe 2.08