SCOPe 2.08: Domain d3bidc2: 3bid C:1-56

Lineage for d3bidc2 (3bid C:1-56)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.348: YegP-like [160112] (1 superfamily)
   comprises two subunits or tandem repeats of beta(3)-alpha-beta motifs; these assemble with the formation of a single beta-sheet and swapping of the C-terminal strands

4. Superfamily d.348.1: YegP-like [160113] (2 families)

5. Family d.348.1.1: YegP-like [160114] (4 proteins)
   Pfam PF07411; DUF1508

6. Protein Uncharacterized protein NMB1088 [160121] (1 species)
   homodimer

7. Species Neisseria meningitidis [TaxId:487] [160122] (1 PDB entry)
   Uniprot Q7DDI1 1-56

8. Domain d3bidc2: 3bid C:1-56 [155301]
   Other proteins in same PDB: d3bida2, d3bidb3, d3bidc3, d3bidd3, d3bide3, d3bidf3, d3bidg3, d3bidh3
   automated match to d3bida1

Details for d3bidc2

PDB Entry: 3bid, 2.7 Å

PDB Description: crystal structure of the nmb1088 protein from neisseria meningitidis. northeast structural genomics consortium target mr91

PDB Compounds: (C:) UPF0339 protein NMB1088

SCOPe Domain Sequences for d3bidc2:

Sequence; same for both SEQRES and ATOM records:

>d3bidc2 d.348.1.1 (C:1-56) Uncharacterized protein NMB1088 {Neisseria meningitidis [TaxId: 487]}
myfeiykdakgeyrwrlkaanheiiaqgegytskqncqhavdllksttaatpvkev

Timeline for d3bidc2:

• d3bidc2 first appeared in SCOP 1.75, called d3bidc1
  
• d3bidc2 appears in SCOPe 2.07