SCOP 1.75: Domain d3bi1a3: 3bi1 A:57-117,A:351-593

Lineage for d3bi1a3 (3bi1 A:57-117,A:351-593)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
   core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops

4. Superfamily c.56.5: Zn-dependent exopeptidases [53187] (9 families)
   core: mixed beta-sheet of 8 strands, order 12435867; strands 2, 6 & 7 are antiparallel to the rest

5. Family c.56.5.5: FolH catalytic domain-like [53210] (2 proteins)

6. Protein Glutamate carboxypeptidase II FOLH1 [142522] (1 species)
   Folate hydrolase 1, FolH homologue

7. Species Human (Homo sapiens) [TaxId:9606] [142523] (14 PDB entries)
   Uniprot Q04609 57-117,351-593

8. Domain d3bi1a3: 3bi1 A:57-117,A:351-593 [155297]
   Other proteins in same PDB: d3bi1a1, d3bi1a2
   automatically matched to d1z8la3
   complexed with 3bi, bma, ca, cl, man, nag, zn

Details for d3bi1a3

PDB Entry: 3bi1, 1.5 Å

PDB Description: x-ray structure of human glutamate carboxypeptidase ii (gcpii) in complex with a transition state analog of methotrexate-glu

PDB Compounds: (A:) glutamate carboxypeptidase 2

SCOP Domain Sequences for d3bi1a3:

Sequence; same for both SEQRES and ATOM records:

>d3bi1a3 c.56.5.5 (A:57-117,A:351-593) Glutamate carboxypeptidase II FOLH1 {Human (Homo sapiens) [TaxId: 9606]}
nmkafldelkaenikkflynftqiphlagteqnfqlakqiqsqwkefgldsvelahydvl
lXevtriynvigtlrgavepdryvilgghrdswvfggidpqsgaavvheivrsfgtlkke
gwrprrtilfaswdaeefgllgstewaeensrllqergvayinadssiegnytlrvdctp
lmyslvhnltkelkspdegfegkslyeswtkkspspefsgmprisklgsgndfevffqrl
giasgrarytknwetnkfsgyplyhsvyetyelvekfydpmfkyhltvaqvrggmvfela
nsivl

Timeline for d3bi1a3:

• d3bi1a3 is new in SCOP 1.75
  
• d3bi1a3 appears in SCOPe 2.01
  
• d3bi1a3 appears in the current release, SCOPe 2.08