Lineage for d3bi0a3 (3bi0 A:57-117,A:351-593)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2887810Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 2889494Superfamily c.56.5: Zn-dependent exopeptidases [53187] (10 families) (S)
    core: mixed beta-sheet of 8 strands, order 12435867; strands 2, 6 & 7 are antiparallel to the rest
  5. 2889859Family c.56.5.5: FolH catalytic domain-like [53210] (2 proteins)
  6. 2889860Protein Glutamate carboxypeptidase II FOLH1 [142522] (1 species)
    Folate hydrolase 1, FolH homologue
  7. 2889861Species Human (Homo sapiens) [TaxId:9606] [142523] (34 PDB entries)
    Uniprot Q04609 57-117,351-593
  8. 2889874Domain d3bi0a3: 3bi0 A:57-117,A:351-593 [155294]
    Other proteins in same PDB: d3bi0a1, d3bi0a2
    automatically matched to d1z8la3
    complexed with bix, ca, cl, nag, zn

Details for d3bi0a3

PDB Entry: 3bi0 (more details), 1.67 Å

PDB Description: x-ray structure of human glutamate carboxypeptidase ii (gcpii) in complex with a transition state analog of glu-glu
PDB Compounds: (A:) glutamate carboxypeptidase 2

SCOPe Domain Sequences for d3bi0a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bi0a3 c.56.5.5 (A:57-117,A:351-593) Glutamate carboxypeptidase II FOLH1 {Human (Homo sapiens) [TaxId: 9606]}
nmkafldelkaenikkflynftqiphlagteqnfqlakqiqsqwkefgldsvelahydvl
lXevtriynvigtlrgavepdryvilgghrdswvfggidpqsgaavvheivrsfgtlkke
gwrprrtilfaswdaeefgllgstewaeensrllqergvayinadssiegnytlrvdctp
lmyslvhnltkelkspdegfegkslyeswtkkspspefsgmprisklgsgndfevffqrl
giasgrarytknwetnkfsgyplyhsvyetyelvekfydpmfkyhltvaqvrggmvfela
nsivl

SCOPe Domain Coordinates for d3bi0a3:

Click to download the PDB-style file with coordinates for d3bi0a3.
(The format of our PDB-style files is described here.)

Timeline for d3bi0a3: