Lineage for d3bi0a2 (3bi0 A:118-350)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2850950Fold c.8: The 'swivelling' beta/beta/alpha domain [52008] (10 superfamilies)
    3 layers: b/b/a; the central sheet is parallel, and the other one is antiparallel; there are some variations in topology
    this domain is thought to be mobile in most multi-domain proteins known to contain it
  4. 2851100Superfamily c.8.4: PA domain [52025] (1 family) (S)
  5. 2851101Family c.8.4.1: PA domain [52026] (2 proteins)
  6. 2851102Protein Glutamate carboxypeptidase II [141984] (1 species)
  7. 2851103Species Human (Homo sapiens) [TaxId:9606] [141985] (34 PDB entries)
    Uniprot Q04609 118-350
  8. 2851116Domain d3bi0a2: 3bi0 A:118-350 [155293]
    Other proteins in same PDB: d3bi0a1, d3bi0a3
    automatically matched to d1z8la2
    complexed with bix, ca, cl, nag, zn

Details for d3bi0a2

PDB Entry: 3bi0 (more details), 1.67 Å

PDB Description: x-ray structure of human glutamate carboxypeptidase ii (gcpii) in complex with a transition state analog of glu-glu
PDB Compounds: (A:) glutamate carboxypeptidase 2

SCOPe Domain Sequences for d3bi0a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bi0a2 c.8.4.1 (A:118-350) Glutamate carboxypeptidase II {Human (Homo sapiens) [TaxId: 9606]}
sypnkthpnyisiinedgneifntslfeppppgyenvsdivppfsafspqgmpegdlvyv
nyartedffklerdmkincsgkiviarygkvfrgnkvknaqlagakgvilysdpadyfap
gvksypdgwnlpgggvqrgnilnlngagdpltpgypaneyayrrgiaeavglpsipvhpi
gyydaqkllekmggsappdsswrgslkvpynvgpgftgnfstqkvkmhihstn

SCOPe Domain Coordinates for d3bi0a2:

Click to download the PDB-style file with coordinates for d3bi0a2.
(The format of our PDB-style files is described here.)

Timeline for d3bi0a2: