Lineage for d3bhxa1 (3bhx A:594-750)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 770413Fold a.48: N-cbl like [47667] (5 superfamilies)
    4 helices; bundle, left-handed twist; left-handed superhelix
  4. 770432Superfamily a.48.2: Transferrin receptor-like dimerisation domain [47672] (1 family) (S)
  5. 770433Family a.48.2.1: Transferrin receptor-like dimerisation domain [47673] (2 proteins)
  6. 770434Protein Glutamate carboxypeptidase II [140574] (1 species)
  7. 770435Species Human (Homo sapiens) [TaxId:9606] [140575] (14 PDB entries)
    Uniprot Q04609 594-750
  8. 770437Domain d3bhxa1: 3bhx A:594-750 [155289]
    Other proteins in same PDB: d3bhxa2, d3bhxa3
    automatically matched to d1z8la1
    complexed with bhx, bma, ca, cl, man, nag, zn

Details for d3bhxa1

PDB Entry: 3bhx (more details), 1.6 Å

PDB Description: x-ray structure of human glutamate carboxypeptidase ii (gcpii) in complex with a transition state analog of asp-glu
PDB Compounds: (A:) glutamate carboxypeptidase 2

SCOP Domain Sequences for d3bhxa1:

Sequence, based on SEQRES records: (download)

>d3bhxa1 a.48.2.1 (A:594-750) Glutamate carboxypeptidase II {Human (Homo sapiens) [TaxId: 9606]}
pfdcrdyavvlrkyadkiysismkhpqemktysvsfdslfsavknfteiaskfserlqdf
dksnpivlrmmndqlmflerafidplglpdrpfyrhviyapsshnkyagesfpgiydalf
dieskvdpskawgevkrqiyvaaftvqaaaetlseva

Sequence, based on observed residues (ATOM records): (download)

>d3bhxa1 a.48.2.1 (A:594-750) Glutamate carboxypeptidase II {Human (Homo sapiens) [TaxId: 9606]}
pfdcrdyavvlrkyadkiysismkhpqemktysvsfdslfsavknfteiaskfserlqdf
snpivlrmmndqlmflerafidplglpdrpfyrhviyapsshnkyagesfpgiydalfdi
eskvdpskawgevkrqiyvaaftvqaaaetlseva

SCOP Domain Coordinates for d3bhxa1:

Click to download the PDB-style file with coordinates for d3bhxa1.
(The format of our PDB-style files is described here.)

Timeline for d3bhxa1: