SCOPe 2.08: Domain d3bhvd2: 3bhv D:309-432

Lineage for d3bhvd2 (3bhv D:309-432)

Root: SCOPe 2.08
Class a: All alpha proteins [46456] (290 folds)
Fold a.74: Cyclin-like [47953] (1 superfamily)
core: 5 helices; one helix is surrounded by the others
Superfamily a.74.1: Cyclin-like [47954] (4 families)
duplication: consists of two domains of this fold
Family a.74.1.1: Cyclin [47955] (9 proteins)
Protein Cyclin A [47956] (2 species)
Species Cow (Bos taurus) [TaxId:9913] [47958] (9 PDB entries)
Domain d3bhvd2: 3bhv D:309-432 [155288]
Other proteins in same PDB: d3bhva1, d3bhva2, d3bhvc1, d3bhvc2
automated match to d1vina2
complexed with mg, sgm, var

Details for d3bhvd2

PDB Entry: 3bhv (more details), 2.1 Å

PDB Description: Structure of phosphorylated Thr160 CDK2/cyclin A in complex with the inhibitor variolin B

PDB Compounds: (D:) Cyclin-A2

SCOPe Domain Sequences for d3bhvd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bhvd2 a.74.1.1 (D:309-432) Cyclin A {Cow (Bos taurus) [TaxId: 9913]}
ptinqfltqyflhqqpanckveslamflgelslidadpylkylpsviaaaafhlalytvt
gqswpeslvqktgytletlkpclldlhqtylrapqhaqqsirekyknskyhgvsllnppe
tlnv

SCOPe Domain Coordinates for d3bhvd2:

Click to download the PDB-style file with coordinates for d3bhvd2.
(The format of our PDB-style files is described here.)

Timeline for d3bhvd2: