Lineage for d3bhvb2 (3bhv B:309-432)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2718075Fold a.74: Cyclin-like [47953] (1 superfamily)
    core: 5 helices; one helix is surrounded by the others
  4. 2718076Superfamily a.74.1: Cyclin-like [47954] (4 families) (S)
    duplication: consists of two domains of this fold
  5. 2718077Family a.74.1.1: Cyclin [47955] (9 proteins)
  6. 2718090Protein Cyclin A [47956] (2 species)
  7. 2718091Species Cow (Bos taurus) [TaxId:9913] [47958] (9 PDB entries)
  8. 2718105Domain d3bhvb2: 3bhv B:309-432 [155286]
    Other proteins in same PDB: d3bhva1, d3bhva2, d3bhvc1, d3bhvc2
    automated match to d1vina2
    complexed with mg, sgm, var

Details for d3bhvb2

PDB Entry: 3bhv (more details), 2.1 Å

PDB Description: Structure of phosphorylated Thr160 CDK2/cyclin A in complex with the inhibitor variolin B
PDB Compounds: (B:) Cyclin-A2

SCOPe Domain Sequences for d3bhvb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bhvb2 a.74.1.1 (B:309-432) Cyclin A {Cow (Bos taurus) [TaxId: 9913]}
ptinqfltqyflhqqpanckveslamflgelslidadpylkylpsviaaaafhlalytvt
gqswpeslvqktgytletlkpclldlhqtylrapqhaqqsirekyknskyhgvsllnppe
tlnv

SCOPe Domain Coordinates for d3bhvb2:

Click to download the PDB-style file with coordinates for d3bhvb2.
(The format of our PDB-style files is described here.)

Timeline for d3bhvb2: