Lineage for d3bhma_ (3bhm A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1826588Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 1826589Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 1826923Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (71 proteins)
    also known as short-chain dehydrogenases and SDR family
    parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7
  6. 1827256Protein Carbonyl reductase/20beta-hydroxysteroid dehydrogenase [63935] (2 species)
  7. 1827257Species Human (Homo sapiens) [TaxId:9606] [141878] (6 PDB entries)
    Uniprot P16152 2-276
  8. 1827261Domain d3bhma_: 3bhm A: [155275]
    automated match to d1wmaa1
    complexed with ab3, ahe, nap, so4

Details for d3bhma_

PDB Entry: 3bhm (more details), 1.8 Å

PDB Description: crystal structure of human carbonyl reductase 1 in complex with s- hydroxymethylglutathione
PDB Compounds: (A:) Carbonyl reductase [NADPH] 1

SCOPe Domain Sequences for d3bhma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bhma_ c.2.1.2 (A:) Carbonyl reductase/20beta-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]}
gihvalvtggnkgiglaivrdlcrlfsgdvvltardvtrgqaavqqlqaeglsprfhqld
iddlqsiralrdflrkeyggldvlvnnagiafkvadptpfhiqaevtmktnffgtrdvct
ellplikpqgrvvnvssimsvralkscspelqqkfrsetiteeelvglmnkfvedtkkgv
hqkegwpssaygvtkigvtvlsriharklseqrkgdkillnaccpgwvrtdmagpkatks
peegaetpvylallppdaegphgqfvsekrveqw

SCOPe Domain Coordinates for d3bhma_:

Click to download the PDB-style file with coordinates for d3bhma_.
(The format of our PDB-style files is described here.)

Timeline for d3bhma_: