Lineage for d3bhka2 (3bhk A:218-321)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2180483Fold d.16: FAD-linked reductases, C-terminal domain [54372] (1 superfamily)
    alpha+beta sandwich
  4. 2180484Superfamily d.16.1: FAD-linked reductases, C-terminal domain [54373] (8 families) (S)
    N-terminal domain is beta/beta/alpha common fold
  5. 2180612Family d.16.1.3: D-aminoacid oxidase-like [54384] (3 proteins)
  6. 2180662Protein Sarcosine oxidase [54388] (1 species)
  7. 2180663Species Bacillus sp., strain b0618 [TaxId:1409] [54389] (17 PDB entries)
  8. 2180666Domain d3bhka2: 3bhk A:218-321 [155272]
    Other proteins in same PDB: d3bhka1, d3bhkb1
    automatically matched to d1el5a2
    complexed with cl, fad, gol; mutant

Details for d3bhka2

PDB Entry: 3bhk (more details), 1.71 Å

PDB Description: crystal structure of r49k mutant of monomeric sarcosine oxidase crystallized in phosphate as precipitant
PDB Compounds: (A:) Monomeric sarcosine oxidase

SCOPe Domain Sequences for d3bhka2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bhka2 d.16.1.3 (A:218-321) Sarcosine oxidase {Bacillus sp., strain b0618 [TaxId: 1409]}
lqpyrqvvgffesdeskysndidfpgfmvevpngiyygfpsfggcglklgyhtfgqkidp
dtinrefgvypedesnlrafleeympgangelkrgavcmytktl

SCOPe Domain Coordinates for d3bhka2:

Click to download the PDB-style file with coordinates for d3bhka2.
(The format of our PDB-style files is described here.)

Timeline for d3bhka2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3bhka1