SCOPe 2.08: Domain d3bhfb1: 3bhf B:1-217,B:322-381

Lineage for d3bhfb1 (3bhf B:1-217,B:322-381)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
   core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander

4. Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (9 families)

5. Family c.3.1.2: FAD-linked reductases, N-terminal domain [51913] (18 proteins)
   C-terminal domain is alpha+beta is common for the family

6. Protein Sarcosine oxidase [51920] (1 species)

7. Species Bacillus sp., strain b0618 [TaxId:1409] [51921] (17 PDB entries)

8. Domain d3bhfb1: 3bhf B:1-217,B:322-381 [155267]
   Other proteins in same PDB: d3bhfa2, d3bhfb2
   automatically matched to d1el5a1
   complexed with cl, fad; mutant

Details for d3bhfb1

PDB Entry: 3bhf, 2.1 Å

PDB Description: crystal structure of r49k mutant of monomeric sarcosine oxidase crystallized in peg as precipitant

PDB Compounds: (B:) Monomeric sarcosine oxidase

SCOPe Domain Sequences for d3bhfb1:

Sequence; same for both SEQRES and ATOM records:

>d3bhfb1 c.3.1.2 (B:1-217,B:322-381) Sarcosine oxidase {Bacillus sp., strain b0618 [TaxId: 1409]}
sthfdvivvgagsmgmaagyqlakqgvktllvdafdpphtngshhgdtkiirhaygegre
yvplalrsqelwyelekethhkiftktgvlvfgpkgesafvaetmeaakehsltvdlleg
deinkrwpgitvpenynaifepnsgvlfsencirayrelaeargakvlthtrvedfdisp
dsvkietangsytadklivsmgawnskllsklnldipXdehfiidlhpehsnvviaagfs
ghgfkfssgvgevlsqlaltgktehdisifsinrpalk

Timeline for d3bhfb1:

• d3bhfb1 first appeared in SCOP 1.75
  
• d3bhfb1 appears in SCOPe 2.07