SCOPe 2.07: Domain d3bhfa2: 3bhf A:218-321

Lineage for d3bhfa2 (3bhf A:218-321)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.16: FAD-linked reductases, C-terminal domain [54372] (1 superfamily)
   alpha+beta sandwich

4. Superfamily d.16.1: FAD-linked reductases, C-terminal domain [54373] (8 families)
   N-terminal domain is beta/beta/alpha common fold

5. Family d.16.1.3: D-aminoacid oxidase-like [54384] (3 proteins)

6. Protein Sarcosine oxidase [54388] (1 species)

7. Species Bacillus sp., strain b0618 [TaxId:1409] [54389] (17 PDB entries)

8. Domain d3bhfa2: 3bhf A:218-321 [155266]
   Other proteins in same PDB: d3bhfa1, d3bhfb1
   automatically matched to d1el5a2
   complexed with cl, fad; mutant

Details for d3bhfa2

PDB Entry: 3bhf, 2.1 Å

PDB Description: crystal structure of r49k mutant of monomeric sarcosine oxidase crystallized in peg as precipitant

PDB Compounds: (A:) Monomeric sarcosine oxidase

SCOPe Domain Sequences for d3bhfa2:

Sequence; same for both SEQRES and ATOM records:

>d3bhfa2 d.16.1.3 (A:218-321) Sarcosine oxidase {Bacillus sp., strain b0618 [TaxId: 1409]}
lqpyrqvvgffesdeskysndidfpgfmvevpngiyygfpsfggcglklgyhtfgqkidp
dtinrefgvypedesnlrafleeympgangelkrgavcmytktl

Timeline for d3bhfa2:

• d3bhfa2 first appeared in SCOP 1.75
  
• d3bhfa2 appears in SCOPe 2.06
  
• d3bhfa2 appears in the current release, SCOPe 2.08