SCOPe 2.08: Domain d3bh9a2: 3bh9 A:1-181

Lineage for d3bh9a2 (3bh9 A:1-181)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)

6. Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (29 species)

7. Species Human (Homo sapiens), HLA-A2.1 [TaxId:9606] [54470] (104 PDB entries)
   Uniprot P01892 25-298

8. Domain d3bh9a2: 3bh9 A:1-181 [155260]
   Other proteins in same PDB: d3bh9a1, d3bh9b2, d3bh9b3
   automatically matched to d1akja2
   complexed with edo, na

Details for d3bh9a2

PDB Entry: 3bh9, 1.7 Å

PDB Description: crystal structure of rty phosphopeptide bound to human class i mhc hla-a2

PDB Compounds: (A:) HLA class I histocompatibility antigen, A-2 alpha chain

SCOPe Domain Sequences for d3bh9a2:

Sequence; same for both SEQRES and ATOM records:

>d3bh9a2 d.19.1.1 (A:1-181) Class I MHC, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-A2.1 [TaxId: 9606]}
gshsmryfftsvsrpgrgeprfiavgyvddtqfvrfdsdaasqrmeprapwieqegpeyw
dgetrkvkahsqthrvdlgtlrgyynqseagshtvqrmygcdvgsdwrflrgyhqyaydg
kdyialkedlrswtaadmaaqttkhkweaahvaeqlraylegtcvewlrrylengketlq
r

Timeline for d3bh9a2:

• d3bh9a2 first appeared in SCOP 1.75
  
• d3bh9a2 appears in SCOPe 2.07