Lineage for d3bh8a2 (3bh8 A:1-181)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1897191Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 1897192Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 1897193Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 1897285Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (28 species)
  7. 1897312Species Human (Homo sapiens), HLA-A2.1 [TaxId:9606] [54470] (92 PDB entries)
    Uniprot P01892 25-298
  8. 1897330Domain d3bh8a2: 3bh8 A:1-181 [155257]
    Other proteins in same PDB: d3bh8a1, d3bh8b_
    automatically matched to d1akja2
    complexed with edo

Details for d3bh8a2

PDB Entry: 3bh8 (more details), 1.65 Å

PDB Description: Crystal Structure of RQA_M Phosphopeptide Bound to HUMAN Class I MHC HLA-A2
PDB Compounds: (A:) HLA class I histocompatibility antigen, A-2 alpha chain

SCOPe Domain Sequences for d3bh8a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bh8a2 d.19.1.1 (A:1-181) Class I MHC, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-A2.1 [TaxId: 9606]}
gshsmryfftsvsrpgrgeprfiavgyvddtqfvrfdsdaasqrmeprapwieqegpeyw
dgetrkvkahsqthrvdlgtlrgyynqseagshtvqrmygcdvgsdwrflrgyhqyaydg
kdyialkedlrswtaadmaaqttkhkweaahvaeqlraylegtcvewlrrylengketlq
r

SCOPe Domain Coordinates for d3bh8a2:

Click to download the PDB-style file with coordinates for d3bh8a2.
(The format of our PDB-style files is described here.)

Timeline for d3bh8a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3bh8a1
View in 3D
Domains from other chains:
(mouse over for more information)
d3bh8b_