SCOPe 2.02: Domain d3bh7a1: 3bh7 A:17-177

Lineage for d3bh7a1 (3bh7 A:17-177)

1. Root: SCOPe 2.02

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (79 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein ADP-ribosylation factor [52614] (15 species)

7. Species Mouse (Mus musculus), ARL3 [TaxId:10090] [52618] (3 PDB entries)

8. Domain d3bh7a1: 3bh7 A:17-177 [155255]
   automatically matched to d1fzqa_
   complexed with alf, gdp, mg

Details for d3bh7a1

PDB Entry: 3bh7, 1.9 Å

PDB Description: Crystal structure of the RP2-Arl3 complex bound to GDP-AlF4

PDB Compounds: (A:) ADP-ribosylation factor-like protein 3

SCOPe Domain Sequences for d3bh7a1:

Sequence; same for both SEQRES and ATOM records:

>d3bh7a1 c.37.1.8 (A:17-177) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]}
evrilllgldnagkttllkqlasedishitptqgfniksvqsqgfklnvwdiggqrkirp
ywrsyfentdiliyvidsadrkrfeetgqeltelleeeklscvpvlifankqdlltaapa
seiaeglnlhtirdrvwqiqscsaltgegvqdgmnwvcknv

Timeline for d3bh7a1:

• d3bh7a1 first appeared in SCOP 1.75
  
• d3bh7a1 appears in SCOPe 2.01
  
• d3bh7a1 is called d3bh7a_ in SCOPe 2.03
  
• d3bh7a1 appears in the current release, SCOPe 2.08, called d3bh7a_