Lineage for d3bh7a_ (3bh7 A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2866675Family c.37.1.8: G proteins [52592] (81 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 2866676Protein ADP-ribosylation factor [52614] (17 species)
  7. 2866740Species Mouse (Mus musculus) [TaxId:10090] [225429] (3 PDB entries)
  8. 2866741Domain d3bh7a_: 3bh7 A: [155255]
    automated match to d1r4aa_
    complexed with alf, gdp, mg

Details for d3bh7a_

PDB Entry: 3bh7 (more details), 1.9 Å

PDB Description: Crystal structure of the RP2-Arl3 complex bound to GDP-AlF4
PDB Compounds: (A:) ADP-ribosylation factor-like protein 3

SCOPe Domain Sequences for d3bh7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bh7a_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus) [TaxId: 10090]}
evrilllgldnagkttllkqlasedishitptqgfniksvqsqgfklnvwdiggqrkirp
ywrsyfentdiliyvidsadrkrfeetgqeltelleeeklscvpvlifankqdlltaapa
seiaeglnlhtirdrvwqiqscsaltgegvqdgmnwvcknv

SCOPe Domain Coordinates for d3bh7a_:

Click to download the PDB-style file with coordinates for d3bh7a_.
(The format of our PDB-style files is described here.)

Timeline for d3bh7a_: