| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) ![]() division into families based on beta-sheet topologies |
| Family c.37.1.8: G proteins [52592] (81 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
| Protein ADP-ribosylation factor [52614] (17 species) |
| Species Mouse (Mus musculus) [TaxId:10090] [225429] (3 PDB entries) |
| Domain d3bh7a_: 3bh7 A: [155255] automated match to d1r4aa_ complexed with alf, gdp, mg |
PDB Entry: 3bh7 (more details), 1.9 Å
SCOPe Domain Sequences for d3bh7a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3bh7a_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus) [TaxId: 10090]}
evrilllgldnagkttllkqlasedishitptqgfniksvqsqgfklnvwdiggqrkirp
ywrsyfentdiliyvidsadrkrfeetgqeltelleeeklscvpvlifankqdlltaapa
seiaeglnlhtirdrvwqiqscsaltgegvqdgmnwvcknv
Timeline for d3bh7a_: