Lineage for d3bgqa1 (3bgq A:33-305)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 874255Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 874256Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (7 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 874317Family d.144.1.7: Protein kinases, catalytic subunit [88854] (63 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 875128Protein Proto-oncogene serine/threonine-protein kinase Pim-1 [118133] (1 species)
    OPK group(?); PIM subfamily; serine/threonine kinase
  7. 875129Species Human (Homo sapiens) [TaxId:9606] [118134] (8 PDB entries)
    Uniprot P11309 33-305
    Uniprot P11309 32-308
    Uniprot P11309 33-305 ! Uniprot P11309 32-308
  8. 875131Domain d3bgqa1: 3bgq A:33-305 [155251]
    automatically matched to d1xqza_
    complexed with vx2

Details for d3bgqa1

PDB Entry: 3bgq (more details), 2 Å

PDB Description: Human Pim-1 kinase in complex with an triazolo pyridazine inhibitor VX2
PDB Compounds: (A:) Proto-oncogene serine/threonine-protein kinase Pim-1

SCOP Domain Sequences for d3bgqa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bgqa1 d.144.1.7 (A:33-305) Proto-oncogene serine/threonine-protein kinase Pim-1 {Human (Homo sapiens) [TaxId: 9606]}
plesqyqvgpllgsggfgsvysgirvsdnlpvaikhvekdrisdwgelpngtrvpmevvl
lkkvssgfsgvirlldwferpdsfvlilerpepvqdlfdfitergalqeelarsffwqvl
eavrhchncgvlhrdikdenilidlnrgelklidfgsgallkdtvytdfdgtrvysppew
iryhryhgrsaavwslgillydmvcgdipfehdeeiirgqvffrqrvssecqhlirwcla
lrpsdrptfeeiqnhpwmqdvllpqetaeihlh

SCOP Domain Coordinates for d3bgqa1:

Click to download the PDB-style file with coordinates for d3bgqa1.
(The format of our PDB-style files is described here.)

Timeline for d3bgqa1: