| Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
| Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (7 families) ![]() shares functional and structural similarities with the ATP-grasp fold and PIPK |
| Family d.144.1.7: Protein kinases, catalytic subunit [88854] (63 proteins) members organized in the groups and subfamiles specified by the comments |
| Protein Proto-oncogene serine/threonine-protein kinase Pim-1 [118133] (1 species) OPK group(?); PIM subfamily; serine/threonine kinase |
| Species Human (Homo sapiens) [TaxId:9606] [118134] (8 PDB entries) Uniprot P11309 33-305 Uniprot P11309 32-308 Uniprot P11309 33-305 ! Uniprot P11309 32-308 |
| Domain d3bgqa1: 3bgq A:33-305 [155251] automatically matched to d1xqza_ complexed with vx2 |
PDB Entry: 3bgq (more details), 2 Å
SCOP Domain Sequences for d3bgqa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3bgqa1 d.144.1.7 (A:33-305) Proto-oncogene serine/threonine-protein kinase Pim-1 {Human (Homo sapiens) [TaxId: 9606]}
plesqyqvgpllgsggfgsvysgirvsdnlpvaikhvekdrisdwgelpngtrvpmevvl
lkkvssgfsgvirlldwferpdsfvlilerpepvqdlfdfitergalqeelarsffwqvl
eavrhchncgvlhrdikdenilidlnrgelklidfgsgallkdtvytdfdgtrvysppew
iryhryhgrsaavwslgillydmvcgdipfehdeeiirgqvffrqrvssecqhlirwcla
lrpsdrptfeeiqnhpwmqdvllpqetaeihlh
Timeline for d3bgqa1: