Lineage for d3bgeb1 (3bge B:251-434)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 772824Fold a.80: post-AAA+ oligomerization domain-like [48018] (1 superfamily)
    core: 5 helices: bundle
  4. 772825Superfamily a.80.1: post-AAA+ oligomerization domain-like [48019] (2 families) (S)
    associated with N-terminal domain from the AAA+ family of P-loop hydrolases
  5. 772886Family a.80.1.2: MgsA/YrvN C-terminal domain-like [158600] (3 proteins)
  6. 772909Protein Uncharacterized protein NTHI1458 [158601] (1 species)
  7. 772910Species Haemophilus influenzae [TaxId:727] [158602] (1 PDB entry)
    Uniprot Q4QL22 251-434
  8. 772912Domain d3bgeb1: 3bge B:251-434 [155246]
    automatically matched to 3BGE A:251-434
    complexed with so4; mutant

Details for d3bgeb1

PDB Entry: 3bge (more details), 1.85 Å

PDB Description: crystal structure of the c-terminal fragment of aaa+atpase from haemophilus influenzae
PDB Compounds: (B:) Predicted ATPase

SCOP Domain Sequences for d3bgeb1:

Sequence, based on SEQRES records: (download)

>d3bgeb1 a.80.1.2 (B:251-434) Uncharacterized protein NTHI1458 {Haemophilus influenzae [TaxId: 727]}
gdrfydlisalhksvrgsapdaalywyariltaggdplyvarrllaiasedvgnadpram
qvalaawdcftrvgayegeraiaqaiiylsvapksnavytafntakqqakdlpdydvpph
lrnaptnlmkelgygaeyryahdepnayaagenyfppelkdtqyyfptnrgmeiqikekl
erlr

Sequence, based on observed residues (ATOM records): (download)

>d3bgeb1 a.80.1.2 (B:251-434) Uncharacterized protein NTHI1458 {Haemophilus influenzae [TaxId: 727]}
gdrfydlisalhksvrgsapdaalywyariltaggdplyvarrllaiasedvgnadpram
qvalaawdcftrvgayegeraiaqaiiylsvapksnavytafntakqqakdlpdydvpph
lrnaptnlmkenyfppelkdtqyyfptnrgmeiqikeklerlr

SCOP Domain Coordinates for d3bgeb1:

Click to download the PDB-style file with coordinates for d3bgeb1.
(The format of our PDB-style files is described here.)

Timeline for d3bgeb1: