Lineage for d3bgeb_ (3bge B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2719131Fold a.80: post-AAA+ oligomerization domain-like [48018] (1 superfamily)
    core: 5 helices: bundle
  4. 2719132Superfamily a.80.1: post-AAA+ oligomerization domain-like [48019] (2 families) (S)
    associated with N-terminal domain from the AAA+ family of P-loop hydrolases
  5. 2719193Family a.80.1.2: MgsA/YrvN C-terminal domain-like [158600] (3 proteins)
    automatically mapped to Pfam PF12002
  6. 2719216Protein Uncharacterized protein NTHI1458 [158601] (1 species)
  7. 2719217Species Haemophilus influenzae [TaxId:727] [158602] (1 PDB entry)
    Uniprot Q4QL22 251-434
  8. 2719219Domain d3bgeb_: 3bge B: [155246]
    automated match to d3bgea1
    complexed with so4

Details for d3bgeb_

PDB Entry: 3bge (more details), 1.85 Å

PDB Description: crystal structure of the c-terminal fragment of aaa+atpase from haemophilus influenzae
PDB Compounds: (B:) Predicted ATPase

SCOPe Domain Sequences for d3bgeb_:

Sequence, based on SEQRES records: (download)

>d3bgeb_ a.80.1.2 (B:) Uncharacterized protein NTHI1458 {Haemophilus influenzae [TaxId: 727]}
gdrfydlisalhksvrgsapdaalywyariltaggdplyvarrllaiasedvgnadpram
qvalaawdcftrvgayegeraiaqaiiylsvapksnavytafntakqqakdlpdydvpph
lrnaptnlmkelgygaeyryahdepnayaagenyfppelkdtqyyfptnrgmeiqikekl
erlr

Sequence, based on observed residues (ATOM records): (download)

>d3bgeb_ a.80.1.2 (B:) Uncharacterized protein NTHI1458 {Haemophilus influenzae [TaxId: 727]}
gdrfydlisalhksvrgsapdaalywyariltaggdplyvarrllaiasedvgnadpram
qvalaawdcftrvgayegeraiaqaiiylsvapksnavytafntakqqakdlpdydvpph
lrnaptnlmkenyfppelkdtqyyfptnrgmeiqikeklerlr

SCOPe Domain Coordinates for d3bgeb_:

Click to download the PDB-style file with coordinates for d3bgeb_.
(The format of our PDB-style files is described here.)

Timeline for d3bgeb_: