![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
![]() | Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) ![]() division into families based on beta-sheet topologies |
![]() | Family c.37.1.0: automated matches [191323] (1 protein) not a true family |
![]() | Protein automated matches [190123] (130 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [186862] (124 PDB entries) |
![]() | Domain d3bfxb_: 3bfx B: [155240] Other proteins in same PDB: d3bfxa1 automated match to d1xv1a_ complexed with a3p |
PDB Entry: 3bfx (more details), 1.8 Å
SCOPe Domain Sequences for d3bfxb_:
Sequence, based on SEQRES records: (download)
>d3bfxb_ c.37.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} klkevegtllqpatvdnwsqiqsfeakpddllictypkagttwiqeivdmieqngdvekc qraiiqhrhpfiewarppqpsgvekakampsprilkthlstqllppsfwennckflyvar nakdcmvsyyhfqrmnhmlpdpgtweeyfetfingkvvwgswfdhvkgwwemkdrhqilf lfyedikrdpkheirkvmqfmgkkvdetvldkivqetsfekmkenpmtnrstvsksildq sissfmrkgtvgdwknhftvaqnerfdeiyrrkmegtsinfsmel
>d3bfxb_ c.37.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} klkevegtllqpatvdnwsqiqsfeakpddllictypkagttwiqeivdmieqnghpfie warppqpsgvekakampsprilkthlstqllppsfwennckflyvarnakdcmvsyyhfq rmnhmlpdpgtweeyfetfingkvvwgswfdhvkgwwemkdrhqilflfyedikrdpkhe irkvmqfmgkketvldkivqetsfekmfmrkgtvgdwknhftvaqnerfdeiyrrkmegt sinfsmel
Timeline for d3bfxb_: