Lineage for d3bfxa1 (3bfx A:12-296)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109203Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2109204Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2109901Family c.37.1.5: PAPS sulfotransferase [52575] (15 protein domains)
    Pfam PF00685
    similar to the nucleotide/nucleoside kinases but transfer sulphate group
  6. 2109978Protein Sulfotransferase Sult1c2 [159556] (1 species)
  7. 2109979Species Human (Homo sapiens) [TaxId:9606] [159557] (1 PDB entry)
    Uniprot O00338 12-296
  8. 2109980Domain d3bfxa1: 3bfx A:12-296 [155239]
    Other proteins in same PDB: d3bfxb_
    complexed with a3p

Details for d3bfxa1

PDB Entry: 3bfx (more details), 1.8 Å

PDB Description: Crystal structure of human sulfotransferase SULT1C1 in complex with PAP
PDB Compounds: (A:) Sulfotransferase 1C2

SCOPe Domain Sequences for d3bfxa1:

Sequence, based on SEQRES records: (download)

>d3bfxa1 c.37.1.5 (A:12-296) Sulfotransferase Sult1c2 {Human (Homo sapiens) [TaxId: 9606]}
klkevegtllqpatvdnwsqiqsfeakpddllictypkagttwiqeivdmieqngdvekc
qraiiqhrhpfiewarppqpsgvekakampsprilkthlstqllppsfwennckflyvar
nakdcmvsyyhfqrmnhmlpdpgtweeyfetfingkvvwgswfdhvkgwwemkdrhqilf
lfyedikrdpkheirkvmqfmgkkvdetvldkivqetsfekmkenpmtnrstvsksildq
sissfmrkgtvgdwknhftvaqnerfdeiyrrkmegtsinfsmel

Sequence, based on observed residues (ATOM records): (download)

>d3bfxa1 c.37.1.5 (A:12-296) Sulfotransferase Sult1c2 {Human (Homo sapiens) [TaxId: 9606]}
klkevegtllqpatvdnwsqiqsfeakpddllictypkagttwiqeivdmieqnghpfie
warppqpsgvekakampsprilkthlstqllppsfwennckflyvarnakdcmvsyyhfq
rmnhmlpdpgtweeyfetfingkvvwgswfdhvkgwwemkdrhqilflfyedikrdpkhe
irkvmqfmgkkvdetvldkivqetsfekmkenfmrkgtvgdwknhftvaqnerfdeiyrr
kmegtsinfsmel

SCOPe Domain Coordinates for d3bfxa1:

Click to download the PDB-style file with coordinates for d3bfxa1.
(The format of our PDB-style files is described here.)

Timeline for d3bfxa1: