SCOPe 2.07: Domain d3bfuc2: 3bfu C:3-263

Lineage for d3bfuc2 (3bfu C:3-263)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.1: Phosphate binding protein-like [53851] (45 protein domains)

6. Protein Glutamate receptor ligand binding core [53881] (5 species)

7. Species Norway rat (Rattus norvegicus), GluR2 [TaxId:10116] [53882] (137 PDB entries)

8. Domain d3bfuc2: 3bfu C:3-263 [155237]
   Other proteins in same PDB: d3bfua3, d3bfuc3
   automated match to d1lbcb_
   protein/RNA complex; complexed with r2p

Details for d3bfuc2

PDB Entry: 3bfu, 1.95 Å

PDB Description: structure of the ligand-binding core of glur2 in complex with the agonist (r)-tdpa at 1.95 a resolution

PDB Compounds: (C:) Glutamate receptor 2

SCOPe Domain Sequences for d3bfuc2:

Sequence; same for both SEQRES and ATOM records:

>d3bfuc2 c.94.1.1 (C:3-263) Glutamate receptor ligand binding core {Norway rat (Rattus norvegicus), GluR2 [TaxId: 10116]}
nktvvvttilespyvmmkknhemlegneryegycvdlaaeiakhcgfkykltivgdgkyg
ardadtkiwngmvgelvygkadiaiapltitlvreevidfskpfmslgisimikkgtpie
saedlskqteiaygtldsgstkeffrrskiavfdkmwtymrsaepsvfvrttaegvarvr
kskgkyayllestmneyieqrkpcdtmkvggnldskgygiatpkgsslgnavnlavlkln
eqglldklknkwwydkgecgs

Timeline for d3bfuc2:

• d3bfuc2 first appeared in SCOP 1.75, called d3bfuc1
  
• d3bfuc2 appears in SCOPe 2.06