SCOPe 2.01: Domain d3bfpa_: 3bfp A:

Lineage for d3bfpa_ (3bfp A:)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.81: Single-stranded left-handed beta-helix [51160] (4 superfamilies)
   superhelix turns are made of parallel beta-strands and (short) turns

4. Superfamily b.81.1: Trimeric LpxA-like enzymes [51161] (9 families)
   superhelical turns are made of three short strands; duplication: the sequence hexapeptide repeats correspond to individual strands

5. Family b.81.1.8: PglD-like [159280] (1 protein)
   contains extra N-terminal alpha/beta subdomain
   this is a repeat family; one repeat unit is 2npo A:101-119 found in domain

6. Protein Acetyltransferase PglD [159281] (1 species)

7. Species Campylobacter jejuni [TaxId:197] [159282] (6 PDB entries)
   Uniprot Q0P9D1 3-197

8. Domain d3bfpa_: 3bfp A: [155234]
   automated match to d2npoa1
   complexed with flc

Details for d3bfpa_

PDB Entry: 3bfp, 1.75 Å

PDB Description: crystal structure of apo-pgld from campylobacter jejuni

PDB Compounds: (A:) Acetyltransferase

SCOPe Domain Sequences for d3bfpa_:

Sequence, based on SEQRES records:

>d3bfpa_ b.81.1.8 (A:) Acetyltransferase PglD {Campylobacter jejuni [TaxId: 197]}
artekiyiygasghglvcedvaknmgykeciflddfkgmkfestlpkydffiaignneir
kkiyqkisengfkivnlihksalispsaiveenagilimpyvvinakakiekgvilntss
viehecvigefshvsvgakcagnvkigkncflginscvlpnlsladdsilgggatlvknq
dekgvfvgvpakrm

Sequence, based on observed residues (ATOM records):

>d3bfpa_ b.81.1.8 (A:) Acetyltransferase PglD {Campylobacter jejuni [TaxId: 197]}
artekiyiygghglvcedvaknmgykecifldstlpkydffiaignneirkkiyqkisen
gfkivnlihksalispsaiveenagilimpyvvinakakiekgvilntssviehecvige
fshvsvgakcagnvkigkncflginscvlpnlsladdsilgggatlvknqdekgvfvgvp
akrm

Timeline for d3bfpa_:

• d3bfpa_ first appeared in SCOP 1.75, called d3bfpa1
  
• d3bfpa_ appears in SCOPe 2.02
  
• d3bfpa_ appears in the current release, SCOPe 2.08