Class b: All beta proteins [48724] (174 folds) |
Fold b.81: Single-stranded left-handed beta-helix [51160] (4 superfamilies) superhelix turns are made of parallel beta-strands and (short) turns |
Superfamily b.81.1: Trimeric LpxA-like enzymes [51161] (8 families) superhelical turns are made of three short strands; duplication: the sequence hexapeptide repeats correspond to individual strands |
Family b.81.1.8: PglD-like [159280] (1 protein) contains extra N-terminal alpha/beta subdomain this is a repeat family; one repeat unit is 2npo A:101-119 found in domain |
Protein Acetyltransferase PglD [159281] (1 species) |
Species Campylobacter jejuni [TaxId:197] [159282] (6 PDB entries) Uniprot Q0P9D1 3-197 |
Domain d3bfpa1: 3bfp A:3-195 [155234] automatically matched to 2NPO A:3-197 complexed with flc |
PDB Entry: 3bfp (more details), 1.75 Å
SCOP Domain Sequences for d3bfpa1:
Sequence, based on SEQRES records: (download)
>d3bfpa1 b.81.1.8 (A:3-195) Acetyltransferase PglD {Campylobacter jejuni [TaxId: 197]} rtekiyiygasghglvcedvaknmgykeciflddfkgmkfestlpkydffiaignneirk kiyqkisengfkivnlihksalispsaiveenagilimpyvvinakakiekgvilntssv iehecvigefshvsvgakcagnvkigkncflginscvlpnlsladdsilgggatlvknqd ekgvfvgvpakrm
>d3bfpa1 b.81.1.8 (A:3-195) Acetyltransferase PglD {Campylobacter jejuni [TaxId: 197]} rtekiyiygghglvcedvaknmgykecifldstlpkydffiaignneirkkiyqkiseng fkivnlihksalispsaiveenagilimpyvvinakakiekgvilntssviehecvigef shvsvgakcagnvkigkncflginscvlpnlsladdsilgggatlvknqdekgvfvgvpa krm
Timeline for d3bfpa1: