Lineage for d3bf1c2 (3bf1 C:119-245)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2883383Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2883384Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. 2884670Family c.55.1.13: CoaX-like [142484] (1 protein)
    Pfam PF03309; Bordetella pertussis Bvg accessory factor family, Baf
  6. 2884671Protein Type III pantothenate kinase, CoaX [142485] (3 species)
  7. 2884686Species Thermotoga maritima [TaxId:2336] [142486] (4 PDB entries)
    Uniprot Q9WZY5 1-118! Uniprot Q9WZY5 119-245
  8. 2884716Domain d3bf1c2: 3bf1 C:119-245 [155215]
    Other proteins in same PDB: d3bf1a3, d3bf1b3, d3bf1c3, d3bf1d3, d3bf1e3, d3bf1f3
    automated match to d3bf3a2
    complexed with adp, pau

Details for d3bf1c2

PDB Entry: 3bf1 (more details), 2.3 Å

PDB Description: Type III pantothenate kinase from Thermotoga maritima complexed with pantothenate and ADP
PDB Compounds: (C:) Type III pantothenate kinase

SCOPe Domain Sequences for d3bf1c2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bf1c2 c.55.1.13 (C:119-245) Type III pantothenate kinase, CoaX {Thermotoga maritima [TaxId: 2336]}
kngiiidmgtattvdlvvngsyeggailpgffmmvhslfrgtaklplvevkpadfvvgkd
teenirlgvvngsvyalegiigrikevygdlpvvltggqskivkdmikheifdedltikg
vyhfcfg

SCOPe Domain Coordinates for d3bf1c2:

Click to download the PDB-style file with coordinates for d3bf1c2.
(The format of our PDB-style files is described here.)

Timeline for d3bf1c2: