| Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
| Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.1: Actin-like ATPase domain [53067] (15 families) ![]() duplication contains two domains of this fold |
| Family c.55.1.13: CoaX-like [142484] (1 protein) Pfam PF03309; Bordetella pertussis Bvg accessory factor family, Baf |
| Protein Type III pantothenate kinase, CoaX [142485] (3 species) |
| Species Thermotoga maritima [TaxId:2336] [142486] (4 PDB entries) Uniprot Q9WZY5 1-118! Uniprot Q9WZY5 119-245 |
| Domain d3bexd1: 3bex D:1-118 [155204] automatically matched to d2gtda1 complexed with pau, po4 |
PDB Entry: 3bex (more details), 1.51 Å
SCOPe Domain Sequences for d3bexd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3bexd1 c.55.1.13 (D:1-118) Type III pantothenate kinase, CoaX {Thermotoga maritima [TaxId: 2336]}
myllvdvgnthsvfsitedgktfrrwrlstgvfqtedelfshlhpllgdamreikgigva
svvptqntvierfsqkyfhispiwvkakngcvkwnvknpsevgadrvanvvafvkeyg
Timeline for d3bexd1: