SCOP 1.75: Domain d3bexc1: 3bex C:1-118

Lineage for d3bexc1 (3bex C:1-118)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (14 families)
   duplication contains two domains of this fold

5. Family c.55.1.13: CoaX-like [142484] (1 protein)
   Pfam PF03309; Bordetella pertussis Bvg accessory factor family, Baf

6. Protein Type III pantothenate kinase, CoaX [142485] (3 species)

7. Species Thermotoga maritima [TaxId:2336] [142486] (4 PDB entries)
   Uniprot Q9WZY5 1-118! Uniprot Q9WZY5 119-245

8. Domain d3bexc1: 3bex C:1-118 [155202]
   automatically matched to d2gtda1
   complexed with pau, po4

Details for d3bexc1

PDB Entry: 3bex, 1.51 Å

PDB Description: Type III pantothenate kinase from Thermotoga maritima complexed with pantothenate

PDB Compounds: (C:) Type III pantothenate kinase

SCOP Domain Sequences for d3bexc1:

Sequence; same for both SEQRES and ATOM records:

>d3bexc1 c.55.1.13 (C:1-118) Type III pantothenate kinase, CoaX {Thermotoga maritima [TaxId: 2336]}
myllvdvgnthsvfsitedgktfrrwrlstgvfqtedelfshlhpllgdamreikgigva
svvptqntvierfsqkyfhispiwvkakngcvkwnvknpsevgadrvanvvafvkeyg

Timeline for d3bexc1:

• d3bexc1 is new in SCOP 1.75
  
• d3bexc1 appears in SCOPe 2.01
  
• d3bexc1 appears in the current release, SCOPe 2.08