SCOP 1.75: Domain d3besl1: 3bes L:0-126

Lineage for d3besl1 (3bes L:0-126)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.26: 4-helical cytokines [47265] (1 superfamily)
   core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections

4. Superfamily a.26.1: 4-helical cytokines [47266] (3 families)
   there are two different topoisomers of this fold with different entanglements of the two crossover connections

5. Family a.26.1.3: Interferons/interleukin-10 (IL-10) [47305] (8 proteins)
   contains an additional helix in one of the crossover connections

6. Protein Interferon-gamma [47318] (3 species)
   intertwined dimer

7. Species Human (Homo sapiens) [TaxId:9606] [47320] (5 PDB entries)

8. Domain d3besl1: 3bes L:0-126 [155196]
   automatically matched to d1fg9a_
   complexed with bma, nag, po4

Details for d3besl1

PDB Entry: 3bes, 2.2 Å

PDB Description: structure of a poxvirus ifngbp/ifng complex

PDB Compounds: (L:) interferon gamma

SCOP Domain Sequences for d3besl1:

Sequence; same for both SEQRES and ATOM records:

>d3besl1 a.26.1.3 (L:0-126) Interferon-gamma {Human (Homo sapiens) [TaxId: 9606]}
mqdpyvkeaenlkkyfnaghsdvadngtlflgilknwkeesdrkimqsqivsfyfklfkn
fkddqsiqksvetikedmnvkffnsnkkkrddfekltnysvtdlnvqrkaiheliqvmae
lspaakt

Timeline for d3besl1:

• d3besl1 is new in SCOP 1.75
  
• d3besl1 is called d3besl_ in SCOPe 2.01
  
• d3besl1 appears in the current release, SCOPe 2.08, called d3besl_