SCOP 1.75: Domain d3bejb1: 3bej B:245-471

Lineage for d3bejb1 (3bej B:245-471)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
   multihelical; 3 layers or orthogonally packed helices

4. Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (1 family)

5. Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (33 proteins)

6. Protein Bile acid receptor FXR [101433] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [101434] (4 PDB entries)

8. Domain d3bejb1: 3bej B:245-471 [155187]
   automatically matched to d1osha_
   complexed with muf, yt3

Details for d3bejb1

PDB Entry: 3bej, 1.9 Å

PDB Description: structure of human fxr in complex with mfa-1 and co-activator peptide

PDB Compounds: (B:) Bile acid receptor

SCOP Domain Sequences for d3bejb1:

Sequence; same for both SEQRES and ATOM records:

>d3bejb1 a.123.1.1 (B:245-471) Bile acid receptor FXR {Human (Homo sapiens) [TaxId: 9606]}
ltpdqqtllhfimdsynkqrmpqeitnkilkeefsaeenfliltematnhvqvlveftkk
lpgfqtldhedqiallkgsaveamflrsaeifnkklpsghsdlleerirnsgisdeyitp
mfsfyksigelkmtqeeyalltaivilspdrqyikdreaveklqeplldvlqklckihqp
enpqhfacllgrltelrtfnhhhaemlmswrvndhkftpllceiwdv

Timeline for d3bejb1:

• d3bejb1 is new in SCOP 1.75
  
• d3bejb1 is called d3bejb_ in SCOPe 2.01
  
• d3bejb1 appears in the current release, SCOPe 2.08, called d3bejb_