SCOPe 2.08: Domain d3bejb_: 3bej B:

Lineage for d3bejb_ (3bej B:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
   multihelical; 3 layers or orthogonally packed helices

4. Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families)

5. Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins)

6. Protein automated matches [190059] (14 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187214] (171 PDB entries)

8. Domain d3bejb_: 3bej B: [155187]
   automated match to d1osha_
   protein/DNA complex; complexed with muf, yt3

Details for d3bejb_

PDB Entry: 3bej, 1.9 Å

PDB Description: structure of human fxr in complex with mfa-1 and co-activator peptide

PDB Compounds: (B:) Bile acid receptor

SCOPe Domain Sequences for d3bejb_:

Sequence; same for both SEQRES and ATOM records:

>d3bejb_ a.123.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eltpdqqtllhfimdsynkqrmpqeitnkilkeefsaeenfliltematnhvqvlveftk
klpgfqtldhedqiallkgsaveamflrsaeifnkklpsghsdlleerirnsgisdeyit
pmfsfyksigelkmtqeeyalltaivilspdrqyikdreaveklqeplldvlqklckihq
penpqhfacllgrltelrtfnhhhaemlmswrvndhkftpllceiwdv

Timeline for d3bejb_:

• d3bejb_ first appeared in SCOP 1.75, called d3bejb1
  
• d3bejb_ appears in SCOPe 2.07