SCOPe 2.06: Domain d3beba1: 3beb A:263-357

Lineage for d3beba1 (3beb A:263-357)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.105: Penicillin-binding protein associated domain [69188] (1 superfamily)
   sandwich; 6 strands in 2 sheets

4. Superfamily b.105.1: Penicillin-binding protein associated domain [69189] (3 families)

5. Family b.105.1.1: PBP5 C-terminal domain-like [69190] (2 proteins)
   automatically mapped to Pfam PF07943

6. Protein Penicillin-binding protein 5, C-terminal domain [69191] (1 species)

7. Species Escherichia coli [TaxId:562] [69192] (11 PDB entries)

8. Domain d3beba1: 3beb A:263-357 [155179]
   Other proteins in same PDB: d3beba2
   automated match to d1nzoa1
   complexed with gol, hj3

Details for d3beba1

PDB Entry: 3beb, 2 Å

PDB Description: Crystal structure of E. coli penicillin-binding protein 5 in complex with a peptide-mimetic penicillin

PDB Compounds: (A:) penicillin-binding protein 5

SCOPe Domain Sequences for d3beba1:

Sequence; same for both SEQRES and ATOM records:

>d3beba1 b.105.1.1 (A:263-357) Penicillin-binding protein 5, C-terminal domain {Escherichia coli [TaxId: 562]}
fetvnplkvgkefasepvwfgdsdraslgvdkdvyltiprgrmkdlkasyvlnsselhap
lqknqvvgtinfqldgktieqrplvvlqeipegnf

Timeline for d3beba1:

• d3beba1 first appeared in SCOP 1.75
  
• d3beba1 appears in SCOPe 2.05
  
• d3beba1 appears in SCOPe 2.07
  
• d3beba1 appears in the current release, SCOPe 2.08