| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families) ![]() the beta-sheet barrel is similarly distorted and capped by a C-terminal helix has transition metal ions bound inside the barrel |
| Family c.1.9.18: Zn-dependent arginine carboxypeptidase-like [159408] (3 proteins) automatically mapped to Pfam PF01979 |
| Protein Zn-dependent arginine carboxypeptidase [159411] (1 species) |
| Species Unidentified organism [TaxId:32644] [159412] (2 PDB entries) |
| Domain d3be7e2: 3be7 E:57-359 [155172] Other proteins in same PDB: d3be7a1, d3be7b1, d3be7c1, d3be7d1, d3be7e1, d3be7f1, d3be7g1, d3be7h1 automatically matched to 3BE7 A:57-359 complexed with arg, gol, mg |
PDB Entry: 3be7 (more details), 2.3 Å
SCOPe Domain Sequences for d3be7e2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3be7e2 c.1.9.18 (E:57-359) Zn-dependent arginine carboxypeptidase {Unidentified organism [TaxId: 32644]}
glmdshvhivgndskgeesiadsshmgtvwgvvnaektlmagfttvrnvgaanyadvsvr
daiergvingptmlvsgpalgitgghcdhnllppefnyssegvvdspwearkmvrknrky
gadlikfcatggvmsrntdvnakqftleemkaivdeahnhgmkvaahahgligikaaika
gvdsvehasfiddetidmaiknntvlsmdifvsdyilgegakagireeslnkerlvgkkq
renfmnahrrgaiitfgtdagifdhgdnakqfaymvewgmtpleaiqastiktatlfgie
nig
Timeline for d3be7e2: