SCOP 1.75: Domain d3be7e2: 3be7 E:57-359

Lineage for d3be7e2 (3be7 E:57-359)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.9: Metallo-dependent hydrolases [51556] (18 families)
   the beta-sheet barrel is similarly distorted and capped by a C-terminal helix
   has transition metal ions bound inside the barrel

5. Family c.1.9.18: Zn-dependent arginine carboxypeptidase-like [159408] (3 proteins)

6. Protein Zn-dependent arginine carboxypeptidase [159411] (1 species)

7. Species Unidentified organism [TaxId:32644] [159412] (2 PDB entries)

8. Domain d3be7e2: 3be7 E:57-359 [155172]
   Other proteins in same PDB: d3be7a1, d3be7b1, d3be7c1, d3be7d1, d3be7e1, d3be7f1, d3be7g1, d3be7h1
   automatically matched to 3BE7 A:57-359
   complexed with arg, gol, mg

Details for d3be7e2

PDB Entry: 3be7, 2.3 Å

PDB Description: crystal structure of zn-dependent arginine carboxypeptidase

PDB Compounds: (E:) Zn-dependent arginine carboxypeptidase

SCOP Domain Sequences for d3be7e2:

Sequence; same for both SEQRES and ATOM records:

>d3be7e2 c.1.9.18 (E:57-359) Zn-dependent arginine carboxypeptidase {Unidentified organism [TaxId: 32644]}
glmdshvhivgndskgeesiadsshmgtvwgvvnaektlmagfttvrnvgaanyadvsvr
daiergvingptmlvsgpalgitgghcdhnllppefnyssegvvdspwearkmvrknrky
gadlikfcatggvmsrntdvnakqftleemkaivdeahnhgmkvaahahgligikaaika
gvdsvehasfiddetidmaiknntvlsmdifvsdyilgegakagireeslnkerlvgkkq
renfmnahrrgaiitfgtdagifdhgdnakqfaymvewgmtpleaiqastiktatlfgie
nig

Timeline for d3be7e2:

• d3be7e2 is new in SCOP 1.75
  
• d3be7e2 appears in SCOPe 2.01
  
• d3be7e2 appears in the current release, SCOPe 2.08