Lineage for d3be7d2 (3be7 D:57-359)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 814174Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 816850Superfamily c.1.9: Metallo-dependent hydrolases [51556] (18 families) (S)
    the beta-sheet barrel is similarly distorted and capped by a C-terminal helix
    has transition metal ions bound inside the barrel
  5. 817219Family c.1.9.18: Zn-dependent arginine carboxypeptidase-like [159408] (3 proteins)
  6. 817234Protein Zn-dependent arginine carboxypeptidase [159411] (1 species)
  7. 817235Species Unidentified organism [TaxId:32644] [159412] (2 PDB entries)
  8. 817239Domain d3be7d2: 3be7 D:57-359 [155170]
    Other proteins in same PDB: d3be7a1, d3be7b1, d3be7c1, d3be7d1, d3be7e1, d3be7f1, d3be7g1, d3be7h1
    automatically matched to 3BE7 A:57-359
    complexed with arg, gol, mg

Details for d3be7d2

PDB Entry: 3be7 (more details), 2.3 Å

PDB Description: crystal structure of zn-dependent arginine carboxypeptidase
PDB Compounds: (D:) Zn-dependent arginine carboxypeptidase

SCOP Domain Sequences for d3be7d2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3be7d2 c.1.9.18 (D:57-359) Zn-dependent arginine carboxypeptidase {Unidentified organism [TaxId: 32644]}
glmdshvhivgndskgeesiadsshmgtvwgvvnaektlmagfttvrnvgaanyadvsvr
daiergvingptmlvsgpalgitgghcdhnllppefnyssegvvdspwearkmvrknrky
gadlikfcatggvmsrntdvnakqftleemkaivdeahnhgmkvaahahgligikaaika
gvdsvehasfiddetidmaiknntvlsmdifvsdyilgegakagireeslnkerlvgkkq
renfmnahrrgaiitfgtdagifdhgdnakqfaymvewgmtpleaiqastiktatlfgie
nig

SCOP Domain Coordinates for d3be7d2:

Click to download the PDB-style file with coordinates for d3be7d2.
(The format of our PDB-style files is described here.)

Timeline for d3be7d2: