SCOP 1.65: Domain d2hhed_: 2hhe D:

Lineage for d2hhed_ (2hhe D:)

1. Root: SCOP 1.65

2. Class a: All alpha proteins [46456] (179 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (4 families)

5. Family a.1.1.2: Globins [46463] (18 proteins)
   Heme-binding protein

6. Protein Hemoglobin, beta-chain [46500] (18 species)

7. Species Human (Homo sapiens) [TaxId:9606] [46501] (100 PDB entries)

8. Domain d2hhed_: 2hhe D: [15517]
   Other proteins in same PDB: d2hhea_, d2hhec_
   complexed with hem; mutant

Details for d2hhed_

PDB Entry: 2hhe, 2.2 Å

PDB Description: oxygen affinity modulation by the n-termini of the beta chains in human and bovine hemoglobin

SCOP Domain Sequences for d2hhed_:

Sequence; same for both SEQRES and ATOM records:

>d2hhed_ a.1.1.2 (D:) Hemoglobin, beta-chain {Human (Homo sapiens)}
mltpeeksavtalwgkvnvdevggealgrllvvypwtqrffesfgdlstpdavmgnpkvk
ahgkkvlgafsdglahldnlkgtfatlselhcdklhvdpenfrllgnvlvcvlahhfgke
ftppvqaayqkvvagvanalahkyh

Timeline for d2hhed_:

• d2hhed_ first appeared (with stable ids) in SCOP 1.55
  
• d2hhed_ appears in SCOP 1.63
  
• d2hhed_ appears in SCOP 1.67
  
• d2hhed_ appears in the current release, SCOPe 2.08