| Class b: All beta proteins [48724] (174 folds) |
| Fold b.92: Composite domain of metallo-dependent hydrolases [51337] (1 superfamily) pseudobarrel; mixed sheet of 7 strand folded upon itself and "buckled" by two beta-turns |
Superfamily b.92.1: Composite domain of metallo-dependent hydrolases [51338] (11 families) ![]() this domain is interrupted by the catalytic beta/alpha barrel domain |
| Family b.92.1.9: Zn-dependent arginine carboxypeptidase-like [159340] (3 proteins) |
| Protein Zn-dependent arginine carboxypeptidase [159343] (1 species) |
| Species Unidentified organism [TaxId:32644] [159344] (2 PDB entries) |
| Domain d3be7c1: 3be7 C:5-56,C:360-398 [155167] Other proteins in same PDB: d3be7a2, d3be7b2, d3be7c2, d3be7d2, d3be7e2, d3be7f2, d3be7g2, d3be7h2 automatically matched to 3BE7 A:3-56,A:360-400 complexed with arg, gol, mg |
PDB Entry: 3be7 (more details), 2.3 Å
SCOP Domain Sequences for d3be7c1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3be7c1 b.92.1.9 (C:5-56,C:360-398) Zn-dependent arginine carboxypeptidase {Unidentified organism [TaxId: 32644]}
dflikskgyldiqtgeiikadllirngkiaeigkintkdatvisipdlilipXqikegfd
adivgvienplanirtleevafvmkegkvykr
Timeline for d3be7c1: