Lineage for d3bdwa_ (3bdw A:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1442549Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 1442550Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 1442551Family d.169.1.1: C-type lectin domain [56437] (29 proteins)
    Pfam PF00059
  6. 1442561Protein CD94 [56440] (1 species)
  7. 1442562Species Human (Homo sapiens) [TaxId:9606] [56441] (4 PDB entries)
  8. 1442563Domain d3bdwa_: 3bdw A: [155161]
    Other proteins in same PDB: d3bdwb_, d3bdwd_
    automated match to d1b6ea_

Details for d3bdwa_

PDB Entry: 3bdw (more details), 2.5 Å

PDB Description: human cd94/nkg2a
PDB Compounds: (A:) Natural killer cells antigen CD94

SCOPe Domain Sequences for d3bdwa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bdwa_ d.169.1.1 (A:) CD94 {Human (Homo sapiens) [TaxId: 9606]}
dccscqekwvgyrcncyfisseqktwnesrhlcasqkssllqlqntdeldfmsssqqfyw
iglsyseehtawlwengsalsqylfpsfetfntknciaynpngnaldescedknryickq
qli

SCOPe Domain Coordinates for d3bdwa_:

Click to download the PDB-style file with coordinates for d3bdwa_.
(The format of our PDB-style files is described here.)

Timeline for d3bdwa_: