Lineage for d3bduc1 (3bdu C:2-53)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 798178Fold b.38: Sm-like fold [50181] (5 superfamilies)
    core: barrel, open; n*=4, S*=8; meander; SH3-like topology
  4. 798179Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (6 families) (S)
  5. 798499Family b.38.1.6: YgdI/YgdR-like [159052] (6 proteins)
    Pfam PF06004; DUF903, putative lipoprotein; both homohexameric and homoheptameric ring assemblies are observed in the crystals
  6. 798508Protein Uncharacterized protein ECA1013 [159057] (1 species)
  7. 798509Species Erwinia carotovora [TaxId:554] [159058] (1 PDB entry)
    Uniprot Q6D8G1 21-73
  8. 798512Domain d3bduc1: 3bdu C:2-53 [155156]
    automatically matched to 3BDU A:2-54

Details for d3bduc1

PDB Entry: 3bdu (more details), 1.9 Å

PDB Description: crystal structure of protein q6d8g1 at the resolution 1.9 a. northeast structural genomics consortium target ewr22a.
PDB Compounds: (C:) Putative lipoprotein

SCOP Domain Sequences for d3bduc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bduc1 b.38.1.6 (C:2-53) Uncharacterized protein ECA1013 {Erwinia carotovora [TaxId: 554]}
ssnyvlhtndgrtivaegkpkvddetgmisytdaygqqqqinrdnvkemakg

SCOP Domain Coordinates for d3bduc1:

Click to download the PDB-style file with coordinates for d3bduc1.
(The format of our PDB-style files is described here.)

Timeline for d3bduc1: