Lineage for d3bcaa_ (3bca A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2130990Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2130991Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2132207Family c.67.1.9: SepSecS-like [159704] (2 protein domains)
    Pfam PF05889
  6. 2132208Protein Selenocysteinyl-tRNA synthase (SepSecS) [159705] (3 species)
  7. 2132219Species Mouse (Mus musculus) [TaxId:10090] [159706] (3 PDB entries)
    Uniprot Q6P6M7 23-467
  8. 2132222Domain d3bcaa_: 3bca A: [155125]
    automated match to d3bc8a1
    complexed with iod

Details for d3bcaa_

PDB Entry: 3bca (more details), 2.25 Å

PDB Description: crystal structure of mouse selenocysteine synthase, sodium iodide soak
PDB Compounds: (A:) O-phosphoseryl-tRNA(Sec) selenium transferase

SCOPe Domain Sequences for d3bcaa_:

Sequence, based on SEQRES records: (download)

>d3bcaa_ c.67.1.9 (A:) Selenocysteinyl-tRNA synthase (SepSecS) {Mouse (Mus musculus) [TaxId: 10090]}
earrahehlirllleqgkcpedgwdestlelflhelavmdsnnflgncgvgeregrvasa
lvarrhyrfihgigrsgdisavqpkaagssllnkitnslvlnviklagvhsvascfvvpm
atgmsltlcfltlrhkrpkakyiiwpridqkscfksmvtagfepvvienvlegdelrtdl
kaveakiqelgpehilclhsttacfaprvpdrleelavicanydiphvvnnayglqsskc
mhliqqgarvgridafvqsldknfmvpvggaiiagfnepfiqdiskmypgrasaspsldv
litllslgcsgyrkllkerkemfvylstqlkklaeahnerllqtphnpislamtlktidg
hhdkavtqlgsmlftrqvsgaravplgnvqtvsghtfrgfmshadnypcaylnaaaaigm
kmqdvdlfikrldkclnivrkeqt

Sequence, based on observed residues (ATOM records): (download)

>d3bcaa_ c.67.1.9 (A:) Selenocysteinyl-tRNA synthase (SepSecS) {Mouse (Mus musculus) [TaxId: 10090]}
earrahehlirllleqgkcpedgwdestlelflhelavmdsnnflgncgvgeregrvasa
lvarrhyrfihgigqpkaagssllnkitnslvlnviklagvhsvascfvvpmatgmsltl
cfltlrhkrpkakyiiwpridqkscfksmvtagfepvvienvlegdelrtdlkaveakiq
elgpehilclhsttacfaprvpdrleelavicanydiphvvnnayglqsskcmhliqqga
rvgridafvqsldknfmvpvggaiiagfnepfiqdiskmypgrasaspsldvlitllslg
csgyrkllkerkemfvylstqlkklaeahnerllqtphnpislamtlktidghhdkavtq
lgsmlftrqvsgaravplgnvqtvsghtfrgfmshadnypcaylnaaaaigmkmqdvdlf
ikrldkclnivrkeqt

SCOPe Domain Coordinates for d3bcaa_:

Click to download the PDB-style file with coordinates for d3bcaa_.
(The format of our PDB-style files is described here.)

Timeline for d3bcaa_: