Lineage for d3bc8a1 (3bc8 A:23-467)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2130990Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2130991Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2132207Family c.67.1.9: SepSecS-like [159704] (2 protein domains)
    Pfam PF05889
  6. 2132208Protein Selenocysteinyl-tRNA synthase (SepSecS) [159705] (3 species)
  7. 2132219Species Mouse (Mus musculus) [TaxId:10090] [159706] (3 PDB entries)
    Uniprot Q6P6M7 23-467
  8. 2132220Domain d3bc8a1: 3bc8 A:23-467 [155124]
    complexed with cl, edo

Details for d3bc8a1

PDB Entry: 3bc8 (more details), 1.65 Å

PDB Description: crystal structure of mouse selenocysteine synthase
PDB Compounds: (A:) O-phosphoseryl-tRNA(Sec) selenium transferase

SCOPe Domain Sequences for d3bc8a1:

Sequence, based on SEQRES records: (download)

>d3bc8a1 c.67.1.9 (A:23-467) Selenocysteinyl-tRNA synthase (SepSecS) {Mouse (Mus musculus) [TaxId: 10090]}
earrahehlirllleqgkcpedgwdestlelflhelavmdsnnflgncgvgeregrvasa
lvarrhyrfihgigrsgdisavqpkaagssllnkitnslvlnviklagvhsvascfvvpm
atgmsltlcfltlrhkrpkakyiiwpridqkscfksmvtagfepvvienvlegdelrtdl
kaveakiqelgpehilclhsttacfaprvpdrleelavicanydiphvvnnayglqsskc
mhliqqgarvgridafvqsldknfmvpvggaiiagfnepfiqdiskmypgrasaspsldv
litllslgcsgyrkllkerkemfvylstqlkklaeahnerllqtphnpislamtlktidg
hhdkavtqlgsmlftrqvsgaravplgnvqtvsghtfrgfmshadnypcaylnaaaaigm
kmqdvdlfikrldkclnivrkeqtr

Sequence, based on observed residues (ATOM records): (download)

>d3bc8a1 c.67.1.9 (A:23-467) Selenocysteinyl-tRNA synthase (SepSecS) {Mouse (Mus musculus) [TaxId: 10090]}
earrahehlirllleqgkcpedgwdestlelflhelavmdsnnflgncgvgeregrvasa
lvarrhyrfihgigrqpkaagssllnkitnslvlnviklagvhsvascfvvpmatgmslt
lcfltlrhkrpkakyiiwpridqkscfksmvtagfepvvienvlegdelrtdlkaveaki
qelgpehilclhsttacfaprvpdrleelavicanydiphvvnnayglqsskcmhliqqg
arvgridafvqsldknfmvpvggaiiagfnepfiqdiskmypgrasaspsldvlitllsl
gcsgyrkllkerkemfvylstqlkklaeahnerllqtphnpislamtlktidghhdkavt
qlgsmlftrqvsgaravplgnvqtvsghtfrgfmshadnypcaylnaaaaigmkmqdvdl
fikrldkclnivrkeqtr

SCOPe Domain Coordinates for d3bc8a1:

Click to download the PDB-style file with coordinates for d3bc8a1.
(The format of our PDB-style files is described here.)

Timeline for d3bc8a1: