Class b: All beta proteins [48724] (176 folds) |
Fold b.155: L21p-like [141090] (1 superfamily) core: sandwich, 6 strands in 2 sheets |
Superfamily b.155.1: L21p-like [141091] (1 family) automatically mapped to Pfam PF00829 |
Family b.155.1.1: Ribosomal protein L21p [141092] (1 protein) Pfam PF00829 |
Protein Ribosomal protein L21p [141093] (3 species) |
Species Escherichia coli [TaxId:562] [141094] (27 PDB entries) Uniprot P0AG48 1-103 |
Domain d3bbxr1: 3bbx R:1-103 [155115] Other proteins in same PDB: d3bbx01, d3bbx11, d3bbx31, d3bbx41, d3bbxc1, d3bbxc2, d3bbxd1, d3bbxe1, d3bbxf1, d3bbxg1, d3bbxg2, d3bbxh1, d3bbxh2, d3bbxj1, d3bbxk1, d3bbxl1, d3bbxm1, d3bbxn1, d3bbxo1, d3bbxp1, d3bbxq1, d3bbxs1, d3bbxt1, d3bbxu1, d3bbxv1, d3bbxw1, d3bbxx1, d3bbxy1, d3bbxz1 automatically matched to d1vs6r1 protein/RNA complex; complexed with mg |
PDB Entry: 3bbx (more details), 10 Å
SCOPe Domain Sequences for d3bbxr1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3bbxr1 b.155.1.1 (R:1-103) Ribosomal protein L21p {Escherichia coli [TaxId: 562]} myavfqsggkqhrvsegqtvrlekldiatgetvefaevlmiangeevkigvpfvdggvik aevvahgrgekvkivkfrrrkhyrkqqghrqwftdvkitgisa
Timeline for d3bbxr1:
View in 3D Domains from other chains: (mouse over for more information) d3bbx01, d3bbx11, d3bbx31, d3bbx41, d3bbxc1, d3bbxc2, d3bbxd1, d3bbxe1, d3bbxf1, d3bbxg1, d3bbxg2, d3bbxh1, d3bbxh2, d3bbxj1, d3bbxk1, d3bbxl1, d3bbxm1, d3bbxn1, d3bbxo1, d3bbxp1, d3bbxq1, d3bbxs1, d3bbxt1, d3bbxu1, d3bbxv1, d3bbxw1, d3bbxx1, d3bbxy1, d3bbxz1 |