Lineage for d3bbxg2 (3bbx G:82-176)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1928241Fold d.141: Ribosomal protein L6 [56052] (1 superfamily)
    consists of two beta-sheets and one alpha-helix packed around single core
  4. 1928242Superfamily d.141.1: Ribosomal protein L6 [56053] (1 family) (S)
    automatically mapped to Pfam PF00347
  5. 1928243Family d.141.1.1: Ribosomal protein L6 [56054] (1 protein)
  6. 1928244Protein Ribosomal protein L6 [56055] (6 species)
    duplication: consists of two domains of this fold
  7. 1928261Species Escherichia coli [TaxId:562] [160796] (27 PDB entries)
    Uniprot P02390 1-81! Uniprot P02390 82-176
  8. 1928315Domain d3bbxg2: 3bbx G:82-176 [155104]
    Other proteins in same PDB: d3bbx01, d3bbx11, d3bbx31, d3bbx41, d3bbxc1, d3bbxc2, d3bbxd1, d3bbxe1, d3bbxf1, d3bbxh1, d3bbxh2, d3bbxj1, d3bbxk1, d3bbxl1, d3bbxm1, d3bbxn1, d3bbxo1, d3bbxp1, d3bbxq1, d3bbxr1, d3bbxs1, d3bbxt1, d3bbxu1, d3bbxv1, d3bbxw1, d3bbxx1, d3bbxy1, d3bbxz1
    automatically matched to 2AW4 G:82-176
    protein/RNA complex; complexed with mg

Details for d3bbxg2

PDB Entry: 3bbx (more details), 10 Å

PDB Description: the hsp15 protein fitted into the low resolution cryo-em map of the 50s.nc-trna.hsp15 complex
PDB Compounds: (G:) 50S ribosomal protein L6

SCOPe Domain Sequences for d3bbxg2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bbxg2 d.141.1.1 (G:82-176) Ribosomal protein L6 {Escherichia coli [TaxId: 562]}
ftkklqlvgvgyraavkgnvinlslgfshpvdhqlpagitaecptqteivlkgadkqvig
qvaadlrayrrpepykgkgvryadevvrtkeakkk

SCOPe Domain Coordinates for d3bbxg2:

Click to download the PDB-style file with coordinates for d3bbxg2.
(The format of our PDB-style files is described here.)

Timeline for d3bbxg2: