Class b: All beta proteins [48724] (174 folds) |
Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies) barrel, closed; n=6, S=10; greek-key |
Superfamily b.43.3: Translation proteins [50447] (6 families) |
Family b.43.3.2: Ribosomal protein L3 [50461] (1 protein) |
Protein Ribosomal protein L3 [50462] (4 species) superfamily fold is elaborated with additional structures |
Species Escherichia coli [TaxId:562] [159159] (29 PDB entries) Uniprot P60438 1-209 |
Domain d3bbxd1: 3bbx D:1-209 [155100] Other proteins in same PDB: d3bbx01, d3bbx11, d3bbx31, d3bbx41, d3bbxc1, d3bbxc2, d3bbxe1, d3bbxf1, d3bbxg1, d3bbxg2, d3bbxh1, d3bbxh2, d3bbxj1, d3bbxk1, d3bbxl1, d3bbxm1, d3bbxn1, d3bbxo1, d3bbxp1, d3bbxq1, d3bbxr1, d3bbxs1, d3bbxt1, d3bbxu1, d3bbxv1, d3bbxw1, d3bbxx1, d3bbxy1, d3bbxz1 automatically matched to 2AW4 D:1-209 complexed with mg |
PDB Entry: 3bbx (more details), 10 Å
SCOP Domain Sequences for d3bbxd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3bbxd1 b.43.3.2 (D:1-209) Ribosomal protein L3 {Escherichia coli [TaxId: 562]} miglvgkkvgmtriftedgvsipvtvieveanrvtqvkdlandgyraiqvttgakkanrv tkpeaghfakagveagrglwefrlaegeeftvgqsisvelfadvkkvdvtgtskgkgfag tvkrwnfrtqdathgnslshrvpgsigqnqtpgkvfkgkkmagqmgnervtvqsldvvrv daernlllvkgavpgatgsdlivkpavka
Timeline for d3bbxd1:
View in 3D Domains from other chains: (mouse over for more information) d3bbx01, d3bbx11, d3bbx31, d3bbx41, d3bbxc1, d3bbxc2, d3bbxe1, d3bbxf1, d3bbxg1, d3bbxg2, d3bbxh1, d3bbxh2, d3bbxj1, d3bbxk1, d3bbxl1, d3bbxm1, d3bbxn1, d3bbxo1, d3bbxp1, d3bbxq1, d3bbxr1, d3bbxs1, d3bbxt1, d3bbxu1, d3bbxv1, d3bbxw1, d3bbxx1, d3bbxy1, d3bbxz1 |