Lineage for d3bbxc2 (3bbx C:61-124)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2058098Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2059387Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families) (S)
  5. 2059775Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (31 proteins)
    barrel, closed; n=5, S=8
  6. 2059900Protein N-terminal domain of ribosomal protein L2 [50299] (5 species)
    incomplete OB-fold lacking the last strand
  7. 2059910Species Escherichia coli [TaxId:562] [159086] (27 PDB entries)
    Uniprot P60422 3-124
  8. 2059937Domain d3bbxc2: 3bbx C:61-124 [155099]
    Other proteins in same PDB: d3bbx01, d3bbx11, d3bbx31, d3bbx41, d3bbxc1, d3bbxd1, d3bbxe1, d3bbxf1, d3bbxg1, d3bbxg2, d3bbxh1, d3bbxh2, d3bbxj1, d3bbxk1, d3bbxl1, d3bbxm1, d3bbxn1, d3bbxo1, d3bbxp1, d3bbxq1, d3bbxr1, d3bbxs1, d3bbxt1, d3bbxu1, d3bbxv1, d3bbxw1, d3bbxx1, d3bbxy1, d3bbxz1
    automatically matched to 2AW4 C:61-124
    protein/RNA complex; complexed with mg

Details for d3bbxc2

PDB Entry: 3bbx (more details), 10 Å

PDB Description: the hsp15 protein fitted into the low resolution cryo-em map of the 50s.nc-trna.hsp15 complex
PDB Compounds: (C:) 50S ribosomal protein L2

SCOPe Domain Sequences for d3bbxc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bbxc2 b.40.4.5 (C:61-124) N-terminal domain of ribosomal protein L2 {Escherichia coli [TaxId: 562]}
yrivdfkrnkdgipavverleydpnrsanialvlykdgerryilapkglkagdqiqsgvd
aaik

SCOPe Domain Coordinates for d3bbxc2:

Click to download the PDB-style file with coordinates for d3bbxc2.
(The format of our PDB-style files is described here.)

Timeline for d3bbxc2: