Class b: All beta proteins [48724] (177 folds) |
Fold b.40: OB-fold [50198] (16 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families) |
Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (31 proteins) barrel, closed; n=5, S=8 |
Protein N-terminal domain of ribosomal protein L2 [50299] (5 species) incomplete OB-fold lacking the last strand |
Species Escherichia coli [TaxId:562] [159086] (27 PDB entries) Uniprot P60422 3-124 |
Domain d3bbxc2: 3bbx C:61-124 [155099] Other proteins in same PDB: d3bbx01, d3bbx11, d3bbx31, d3bbx41, d3bbxc1, d3bbxd1, d3bbxe1, d3bbxf1, d3bbxg1, d3bbxg2, d3bbxh1, d3bbxh2, d3bbxj1, d3bbxk1, d3bbxl1, d3bbxm1, d3bbxn1, d3bbxo1, d3bbxp1, d3bbxq1, d3bbxr1, d3bbxs1, d3bbxt1, d3bbxu1, d3bbxv1, d3bbxw1, d3bbxx1, d3bbxy1, d3bbxz1 automatically matched to 2AW4 C:61-124 protein/RNA complex; complexed with mg |
PDB Entry: 3bbx (more details), 10 Å
SCOPe Domain Sequences for d3bbxc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3bbxc2 b.40.4.5 (C:61-124) N-terminal domain of ribosomal protein L2 {Escherichia coli [TaxId: 562]} yrivdfkrnkdgipavverleydpnrsanialvlykdgerryilapkglkagdqiqsgvd aaik
Timeline for d3bbxc2:
View in 3D Domains from other chains: (mouse over for more information) d3bbx01, d3bbx11, d3bbx31, d3bbx41, d3bbxd1, d3bbxe1, d3bbxf1, d3bbxg1, d3bbxg2, d3bbxh1, d3bbxh2, d3bbxj1, d3bbxk1, d3bbxl1, d3bbxm1, d3bbxn1, d3bbxo1, d3bbxp1, d3bbxq1, d3bbxr1, d3bbxs1, d3bbxt1, d3bbxu1, d3bbxv1, d3bbxw1, d3bbxx1, d3bbxy1, d3bbxz1 |