Lineage for d3bbua1 (3bbu A:5-108)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 864567Fold d.66: Alpha-L RNA-binding motif [55173] (1 superfamily)
    alpha(2)-beta(2)-loop-beta; 2 layers: alpha/beta
  4. 864568Superfamily d.66.1: Alpha-L RNA-binding motif [55174] (5 families) (S)
    common motif in otherwise different folds
  5. 864647Family d.66.1.3: Heat shock protein 15 kD [55182] (1 protein)
    there are additional C-terminal structures
  6. 864648Protein Heat shock protein 15 kD [55183] (1 species)
    ribosome-binding protein
  7. 864649Species Escherichia coli [TaxId:562] [55184] (2 PDB entries)
  8. 864652Domain d3bbua1: 3bbu A:5-108 [155093]
    automatically matched to d1dm9b_

Details for d3bbua1

PDB Entry: 3bbu (more details), 10 Å

PDB Description: the hsp15 protein fitted into the low resolution cryo-em map of the 50s.nc-trna.hsp15 complex
PDB Compounds: (A:) Heat Shock Protein 15

SCOP Domain Sequences for d3bbua1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bbua1 d.66.1.3 (A:5-108) Heat shock protein 15 kD {Escherichia coli [TaxId: 562]}
pavevrldkwlwaarfyktralaremieggkvhyngqrskpskivelnatltlrqgnder
tvivkaiteqrrpaseaallyeetaesvekrekmalarklnalt

SCOP Domain Coordinates for d3bbua1:

Click to download the PDB-style file with coordinates for d3bbua1.
(The format of our PDB-style files is described here.)

Timeline for d3bbua1: