![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.66: Alpha-L RNA-binding motif [55173] (1 superfamily) alpha(2)-beta(2)-loop-beta; 2 layers: alpha/beta |
![]() | Superfamily d.66.1: Alpha-L RNA-binding motif [55174] (5 families) ![]() common motif in otherwise different folds |
![]() | Family d.66.1.3: Heat shock protein 15 kD [55182] (2 proteins) there are additional C-terminal structures |
![]() | Protein Heat shock protein 15 kD [55183] (1 species) ribosome-binding protein |
![]() | Species Escherichia coli [TaxId:562] [55184] (2 PDB entries) |
![]() | Domain d3bbua1: 3bbu A:5-108 [155093] automatically matched to d1dm9b_ protein/RNA complex |
PDB Entry: 3bbu (more details), 10 Å
SCOPe Domain Sequences for d3bbua1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3bbua1 d.66.1.3 (A:5-108) Heat shock protein 15 kD {Escherichia coli [TaxId: 562]} pavevrldkwlwaarfyktralaremieggkvhyngqrskpskivelnatltlrqgnder tvivkaiteqrrpaseaallyeetaesvekrekmalarklnalt
Timeline for d3bbua1: