| Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
| Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest |
Superfamily c.94.1: Periplasmic binding protein-like II [53850] (3 families) ![]() Similar in architecture to the superfamily I but partly differs in topology |
| Family c.94.1.1: Phosphate binding protein-like [53851] (40 proteins) |
| Protein Glutamate receptor ligand binding core [53881] (4 species) |
| Species Rat (Rattus norvegicus), GluR2 [TaxId:10116] [53882] (57 PDB entries) |
| Domain d3bbrb1: 3bbr B:3-261 [155092] automatically matched to d1lbcb_ complexed with bhy, cl, glu, gol, so4; mutant |
PDB Entry: 3bbr (more details), 2.25 Å
SCOP Domain Sequences for d3bbrb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3bbrb1 c.94.1.1 (B:3-261) Glutamate receptor ligand binding core {Rat (Rattus norvegicus), GluR2 [TaxId: 10116]}
nktvvvttilespyvmmkknhemlegneryegycvdlaaeiakhcgfkykltivgdgkyg
ardadtkiwngmvgelvygkadiaiapltitlvreevidfskpfmslgisimikkgtpie
saedlskqteiaygtldsgstkeffrrskiavfdkmwtymrsaepsvfvrttaegvarvr
kskgkyayllestmneyieqrkpcdtmkvggnldskgygiatpkgsslgnavnlavlkls
eqglldklknkwwydkgec
Timeline for d3bbrb1: